DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and Tsp2A

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster


Alignment Length:236 Identity:59/236 - (25%)
Similarity:99/236 - (41%) Gaps:40/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FALF------WDIILALFGLVV-----IGLGVHI-IYKFEHFNTAAFVIIAVGVVVVLTALFGAL 63
            :.||      |.|..|||.|.|     .|....: |.:.:.|....:|:|.:.:|::..:..|.|
  Fly    21 YTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQSFYIGVYVLIGISIVMMAVSFLGCL 85

  Fly    64 GAARESSATSKVFVVILIVLVILEVLAVGFLWVFQT---SL--LINVD-----KTFDKLWNDQPV 118
            .|..|::....|||...:...|..|.....|..|.|   ||  |:||.     .|.:..:::.  
  Fly    86 SALMENTLALFVFVGTQVFGFIAIVAGSAVLLQFSTINSSLQPLLNVSLRGFVATSEYTYSNY-- 148

  Fly   119 PIKPGNQSQIASLERWLDCCGNVGPSDYI---LP-PNSCYNGESDKLNLEGCRQKFLDFIADR-- 177
                    .:..::..:.|||..||.||:   .| |:||.:..|......||..:...|...:  
  Fly   149 --------VLTMIQENIGCCGATGPWDYLDLRQPLPSSCRDTVSGNAFFNGCVDELTWFFEGKTG 205

  Fly   178 WTTFNLVSLVLLGVELICALLAYVLANSIVNRWRRSKYYQK 218
            |.....::|.||.|  |||::::||..::.....::..|::
  Fly   206 WIVALAMTLGLLNV--ICAVMSFVLVQAVKKEEEQASNYRR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 53/206 (26%)
tetraspanin_LEL 95..176 CDD:239401 23/94 (24%)
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 58/222 (26%)
tetraspanin_LEL 116..204 CDD:239401 24/97 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.