DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and Cd63

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_008763246.1 Gene:Cd63 / 29186 RGDID:62080 Length:262 Species:Rattus norvegicus


Alignment Length:240 Identity:63/240 - (26%)
Similarity:103/240 - (42%) Gaps:54/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LFWDIILAL----FGLVVIGLGVHIIYK--FEHFNTAA----FVIIAVGVVVVLTALFGALGAAR 67
            |.:.::||.    .||:.||:.|.::.|  ..|..||.    .||||||..:.|.|..|..||.:
  Rat    37 LLYVLLLAFCACAVGLIAIGVAVQVVLKQAITHETTAGSLLPVVIIAVGAFLFLVAFVGCCGACK 101

  Fly    68 ESSATSKVFVVILIVLVILEVLAVGFLWVFQTSLLINVDKTFDK-----LWNDQPVPIKPGNQSQ 127
            |:......|.:.|.:::::||......:||:..:.....|:|.|     |.:::...|       
  Rat   102 ENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFSKSFQKQMQNYLTDNKTATI------- 159

  Fly   128 IASLERWLDCCGNVGPSDY---------ILPPNSCYN-----GESDK---LNLEGCRQKFLDFIA 175
            :..|::...|||....:|:         .:|.:.|.|     |...|   ::.:||    ::.||
  Rat   160 LDKLQKENKCCGASNYTDWERIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGC----VETIA 220

  Fly   176 DRWTTFN--LVSLVLLG---VELICALLAYVLANSIVNRWRRSKY 215
             .|...|  ||:...||   ||::..:.:..|..||     ||.|
  Rat   221 -AWLRKNVLLVAGAALGIAFVEVLGIIFSCCLVKSI-----RSGY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 56/221 (25%)
tetraspanin_LEL 95..176 CDD:239401 20/102 (20%)
Cd63XP_008763246.1 Tetraspannin 33..255 CDD:278750 58/229 (25%)
ATP-synt_A <72..131 CDD:294288 18/58 (31%)
CD63_LEL 129..227 CDD:239419 22/109 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.