Sequence 1: | NP_523633.1 | Gene: | Tsp42Eg / 35616 | FlyBaseID: | FBgn0033128 | Length: | 218 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492404.1 | Gene: | tsp-15 / 192065 | WormBaseID: | WBGene00006641 | Length: | 258 | Species: | Caenorhabditis elegans |
Alignment Length: | 207 | Identity: | 35/207 - (16%) |
---|---|---|---|
Similarity: | 66/207 - (31%) | Gaps: | 78/207 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 IILALFGLVVIGLGVHIIYKFEHF----NTAAFV-----IIAVGVVVVLT------ALFGALGAA 66
Fly 67 RESSATSKVFVVILIVLVILEVLAVGFLWVFQTSLLINVDKTFDKLWNDQPVPIKPGNQSQIASL 131
Fly 132 -------------ERW------LDCCGNVGPSD-----------------YILPPNSCYNGESDK 160
Fly 161 LNLEGCRQKFLD 172 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tsp42Eg | NP_523633.1 | Tetraspannin | 17..202 | CDD:395265 | 35/207 (17%) |
tetraspanin_LEL | 95..176 | CDD:239401 | 19/114 (17%) | ||
tsp-15 | NP_492404.1 | Tetraspannin | 16..256 | CDD:278750 | 35/207 (17%) |
uroplakin_I_like_LEL | 110..228 | CDD:239409 | 20/120 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3882 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1051357at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |