DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and tsp-15

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_492404.1 Gene:tsp-15 / 192065 WormBaseID:WBGene00006641 Length:258 Species:Caenorhabditis elegans


Alignment Length:207 Identity:35/207 - (16%)
Similarity:66/207 - (31%) Gaps:78/207 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IILALFGLVVIGLGVHIIYKFEHF----NTAAFV-----IIAVGVVVVLT------ALFGALGAA 66
            :|..||.:..|..|:.::.:...:    :.:.:|     ::.:.::.:|.      |:|..:...
 Worm    25 LISILFSISCICYGIWLLARRSQYAELVSPSLYVDVGRILVIISILSILNYLICFYAIFKEMRCF 89

  Fly    67 RESSATSKVFVVILIVLVILEVLAVGFLWVFQTSLLINVDKTFDKLWNDQPVPIKPGNQSQIASL 131
            ..|.|.:.  :||.::|:|...:.:.|                    .||.....|.|...:.||
 Worm    90 VTSCAVAS--IVIAVMLIIGGCIGLNF--------------------RDQLTHYTPLNLKMLTSL 132

  Fly   132 -------------ERW------LDCCGNVGPSD-----------------YILPPNSCYNGESDK 160
                         |.|      ..|||..|..:                 .::|.:.|...|   
 Worm   133 RELYGTHDMKGITESWDALQSNFKCCGVNGTDNAQIWKTSKWYMHQRAPKLLIPESCCIPSE--- 194

  Fly   161 LNLEGCRQKFLD 172
              :|.||....|
 Worm   195 --IERCRSNPFD 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 35/207 (17%)
tetraspanin_LEL 95..176 CDD:239401 19/114 (17%)
tsp-15NP_492404.1 Tetraspannin 16..256 CDD:278750 35/207 (17%)
uroplakin_I_like_LEL 110..228 CDD:239409 20/120 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.