DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and Prph2

DIOPT Version :10

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_032964.1 Gene:Prph2 / 19133 MGIID:102791 Length:346 Species:Mus musculus


Alignment Length:268 Identity:61/268 - (22%)
Similarity:101/268 - (37%) Gaps:87/268 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WDIILALFGLVVIGLG----VHIIYKFEHFNTAA--FV---IIAVGVV-VVLTALFG-----ALG 64
            |..:||  |:|:..||    :.:..:.|..|.:.  ||   :|.|||: .|..:|.|     ||.
Mouse    25 WLSVLA--GIVLFSLGLFLKIELRKRSEVMNNSESHFVPNSLIGVGVLSCVFNSLAGKICYDALD 87

  Fly    65 AARESS---------ATSKVFVVILIVLVILEVLAVGFLWVFQTSLLINVDKTFDKLWNDQPVPI 120
            .|:.:.         |....|.|||.::.:...|..|.|   :::|...: |...|.:.|...|.
Mouse    88 PAKYAKWKPWLKPYLAVCIFFNVILFLVALCCFLLRGSL---ESTLAYGL-KNGMKYYRDTDTPG 148

  Fly   121 KPGNQSQIASLERWLDCCGNVGPSD------------------------------YILP--PNSC 153
            :...:..|..|:....||||.|..|                              |::.  |.||
Mouse   149 RCFMKKTIDMLQIEFKCCGNNGFRDWFEIQWISNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSC 213

  Fly   154 ----------------------YNGESDKLN--LEGCRQKFLDFIADRWTTFNLVSLVLLGVEL- 193
                                  |:.::::||  |.|||...|::.:....:..:|:|::...|: 
Mouse   214 CNPSSPRPCIQYQLTNNSAHYSYDHQTEELNLWLRGCRAALLNYYSSLMNSMGVVTLLVWLFEVS 278

  Fly   194 ICALLAYV 201
            |.|.|.|:
Mouse   279 ITAGLRYL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspanin 17..204 CDD:459767 60/266 (23%)
tetraspanin_LEL 95..176 CDD:239401 25/136 (18%)
Prph2NP_032964.1 Tetraspanin 16..181 CDD:459767 42/161 (26%)
peripherin_like_LEL 120..262 CDD:239415 28/145 (19%)
Interaction with MREG. /evidence=ECO:0000269|PubMed:17260955 341..346
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.