DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and tsp-20

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_510014.1 Gene:tsp-20 / 181376 WormBaseID:WBGene00006646 Length:279 Species:Caenorhabditis elegans


Alignment Length:233 Identity:51/233 - (21%)
Similarity:86/233 - (36%) Gaps:62/233 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LFWDIILALFGLVVIGLGVHIIYKF---------EHFNT-AAFVIIAVGVVVVLTALFGALGAAR 67
            ||...:|.:.|::.:.|.:. :|.|         .||.. ..::.:..||..|:      :|...
 Worm    29 LFISYLLVIVGILFLALAIW-LYIFRGDLIPLIQSHFYVKCIYLAVGCGVFNVI------IGFLV 86

  Fly    68 ESSATSKVFVVILIVLVILEVLAVGFLWVFQTSLLINVDKTFD-KLWND--QPVPIKPGNQSQIA 129
            .|:.:::..:|..::::|..::..|.|..|..|.....::..: .|.||  ....:.|.....:.
 Worm    87 HSAVSNRCALVFYLLMLIFSMIMEGCLIYFTFSYHATYEQELNASLPNDILNNYNLDPNIAKAVN 151

  Fly   130 SLERWLDCCG----NVGP----SDYILP------------PNSCYNGE--------SDKLN---L 163
            .|:|...|||    |..|    .|:.||            |:||....        ||..|   .
 Worm   152 YLQRDSKCCGSNAFNDWPKPEVEDHYLPYAKTVVQRVQYIPDSCCKSTHQRKGCALSDSPNNIFY 216

  Fly   164 EGCRQKFLDFIADR-WTTFNLV------SLVLLGVELI 194
            .||    |.|:.:. :...|.:      ||||....||
 Worm   217 RGC----LPFLKEEVYNNLNFLFTVTAASLVLHFANLI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 49/229 (21%)
tetraspanin_LEL 95..176 CDD:239401 26/114 (23%)
tsp-20NP_510014.1 Tetraspannin 24..258 CDD:278750 51/233 (22%)
CD151_like_LEL 118..231 CDD:239408 25/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.