DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and Cd63

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001036045.1 Gene:Cd63 / 12512 MGIID:99529 Length:238 Species:Mus musculus


Alignment Length:236 Identity:62/236 - (26%)
Similarity:104/236 - (44%) Gaps:46/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LFWDIILAL----FGLVVIGLGVHIIYK--FEHFNTAA----FVIIAVGVVVVLTALFGALGAAR 67
            |.:.::||.    .||:.||:.|.::.|  ..|..||.    .||||||..:.|.|..|..||.:
Mouse    13 LLYVLLLAFCACAVGLIAIGVAVQVVLKQAITHETTAGSLLPVVIIAVGAFLFLVAFVGCCGACK 77

  Fly    68 ESSATSKVFVVILIVLVILEVLAVGFLWVFQTSLLINVDKTFDKLWNDQPVPIKPGNQSQIA-SL 131
            |:......|.:.|.:::::||......:||:..:....:|:|.:...:.   :|....:.|. .|
Mouse    78 ENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFNKSFQQQMQNY---LKDNKTATILDKL 139

  Fly   132 ERWLDCCGNVGPSDY---------ILPPNSCYN-----GESDK---LNLEGCRQKFLDFIADRWT 179
            ::..:|||....:|:         .:|.:.|.|     |...|   ::.:||    ::.|| .|.
Mouse   140 QKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGC----VETIA-IWL 199

  Fly   180 TFN--LVSLVLLG---VELICALLAYVLANSIVNRWRRSKY 215
            ..|  ||:...||   ||::..:.:..|..||     ||.|
Mouse   200 RKNILLVAAAALGIAFVEVLGIIFSCCLVKSI-----RSGY 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 55/217 (25%)
tetraspanin_LEL 95..176 CDD:239401 19/98 (19%)
Cd63NP_001036045.1 Tetraspannin 10..227 CDD:395265 56/221 (25%)
CD63_LEL 105..203 CDD:239419 21/105 (20%)
Lysosomal targeting motif. /evidence=ECO:0000269|PubMed:21041449 234..238 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.