DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and Cd151

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001104519.1 Gene:Cd151 / 12476 MGIID:1096360 Length:253 Species:Mus musculus


Alignment Length:241 Identity:51/241 - (21%)
Similarity:101/241 - (41%) Gaps:40/241 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CSTNVLKGFALFWDIILALFGLVVIGLGV-HIIYKFEHFN--------TAAFVIIAVGVVVVLTA 58
            |.|..||.....::....|.||.|:.:|: .:..|.::.:        ..|::::..||||::|.
Mouse    11 CGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASSTYLATAYILVVAGVVVMVTG 75

  Fly    59 LFGALGAARESSATSKVFVVILIVLVILEVLAVGFLWVF----QTSLLINVDKTFDKLWNDQPVP 119
            :.|.....:|.....:::.::|:::.:||::|....:|:    .|.|..|:..|..|.::...  
Mouse    76 VLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYVYYQQLNTELKENLKDTMVKRYHQSG-- 138

  Fly   120 IKPGNQSQIASLERWLDCCGN-------------VGPSDYILPPNSCYN------GESDKLN--- 162
             ..|..|.:..|::...|||:             .|.:|..:.|:||..      |:.|..:   
Mouse   139 -HEGVSSAVDKLQQEFHCCGSNNSQDWQDSEWIRSGEADSRVVPDSCCKTMVAGCGKRDHASNIY 202

  Fly   163 -LE-GCRQKFLDFIADRWTTFNLVSLVLLGVELICALLAYVLANSI 206
             :| ||..|...||.:.......|.:.:..|::...:....|..|:
Mouse   203 KVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 45/221 (20%)
tetraspanin_LEL 95..176 CDD:239401 25/108 (23%)
Cd151NP_001104519.1 Tetraspannin 15..248 CDD:278750 48/235 (20%)
CD151_like_LEL 112..220 CDD:239408 25/110 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.