DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and Tsp68C

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster


Alignment Length:292 Identity:59/292 - (20%)
Similarity:97/292 - (33%) Gaps:116/292 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MACSTNVLKGFAL-FWDIILALFGLVVIGLGVHIIYKFEH----------------------FNT 42
            |||..|.  .|.| ..:.:..:.||:::..|::|....:.                      |..
  Fly     1 MACCFNY--KFVLNLCNFLFLICGLLLVVSGLYIFSDNKRILLSRLLAASSDRLSSLPQPLLFYI 63

  Fly    43 AAFVIIAVGVVVVLTALFGALGAARESSATSKVFVVILIVLVILE-VLAVGF-LWVFQTSLLINV 105
            |..|.|| |.|..|.|:.|...:...:.....::.:.::||::.| ||.:.. ||  ...|.|::
  Fly    64 ALGVAIA-GFVATLAAVVGFWASCLHTYCFLTIYFLSVVVLLLTESVLCLAITLW--PHCLGISL 125

  Fly   106 DKT---------------------------------------FD-KLWNDQ-------PVPI--- 120
            |:|                                       :| .||..|       |||:   
  Fly   126 DETQMVRSLQSNYGVPGQEQFTNALDLAQVRFGCCGMRSSLDYDTSLWRLQGYGQRNWPVPLSCC 190

  Fly   121 --------------KPGNQSQIASLERWLDCCGNVGPSDYILPPNSCYNGESDKLNLEGCRQKFL 171
                          ||.|:|...||||                  ..|..|.   :.|.|.....
  Fly   191 FLKNAGHSMAYLDPKPANESMCQSLER------------------LSYERER---HTESCLPHLD 234

  Fly   172 DFIADRWTTFNLVSLVLLGVELICALLAYVLA 203
            ::..::::.|...||:|..:| .|.|||.:::
  Fly   235 NWYREQYSIFLGASLILAMIE-FCVLLAIIMS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 53/272 (19%)
tetraspanin_LEL 95..176 CDD:239401 24/144 (17%)
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 55/283 (19%)
tetraspanin_LEL 117..241 CDD:239401 24/146 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.