DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and LOC101732684

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_031754544.1 Gene:LOC101732684 / 101732684 -ID:- Length:232 Species:Xenopus tropicalis


Alignment Length:216 Identity:51/216 - (23%)
Similarity:90/216 - (41%) Gaps:46/216 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GLVVIGLGV-HIIYKFEHFN--------TAAFVIIAVGVVVVLTALFGALGAARESSATSKVFVV 78
            |..||.:|. .::.|..:.|        .:|::::..|.||::....|.....||......|::.
 Frog     3 GAAVITIGAWTLMEKSGYINFLATSTLAVSAYILLFAGGVVMVAGFLGCGAMIREHKGCLTVYLS 67

  Fly    79 ILIVLVILEVLA--VGFLW--VFQTSLLINVDKTFDKLWNDQPVPIKPGNQ---SQIASLERWLD 136
            |||.:...|:.|  :.:|:  .....|..|::||..:.:      .:||.:   |.|..|::...
 Frog    68 ILISVYAAELAAGVLAYLYHETISEELKQNLNKTIVETY------AEPGKKHITSAIDHLQQDFH 126

  Fly   137 CCGNVG-----PSDYI--------LPPNSC------YNGESDK----LNLE-GCRQKFLDFIADR 177
            |||:..     .|:||        :.|:||      :.|..|.    ..:| ||..|..:||.:.
 Frog   127 CCGSGSYNDWQHSEYISSTQSEDRVVPDSCCKTKTLHCGRRDHPSNIYRVEGGCITKLEEFIQEH 191

  Fly   178 WTTFNLVSLVLLGVELICALL 198
            ......||:.:..::|:..||
 Frog   192 LLLIGAVSIGIACLQLVGVLL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 51/216 (24%)
tetraspanin_LEL 95..176 CDD:239401 26/109 (24%)
LOC101732684XP_031754544.1 CD151_like_LEL 84..192 CDD:239408 27/113 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.