DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and CD63

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001244318.1 Gene:CD63 / 967 HGNCID:1692 Length:238 Species:Homo sapiens


Alignment Length:248 Identity:59/248 - (23%)
Similarity:103/248 - (41%) Gaps:50/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASTSSVKLIVYALDVLCTLLA-------LVLISFGIYVAVSYNLNE---IGQLTAYGYVGLGAA 55
            ||....:|.:.:.|.||  |||       |:.:..|..:.:|..:.:   .|.|.....:.:|..
Human     1 MAVEGGMKCVKFLLYVL--LLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVF 63

  Fly    56 ALLVVLWGYLSAWRENVCCTVTFIIFLCLVIIAQFAVVYL-LITQEKTVA---SNLANALEATWE 116
            ..||...|...|.:||.|..:||.|||.|:::.:.|.... .:.::|.::   :|....:| .:.
Human    64 LFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQME-NYP 127

  Fly   117 EELNSPGAMSLYQNWFQCCGRGSPQDYIVNERLP-------PETCFRNHDKSKPENLIHTGCRVE 174
            :..::...:...|..|:|||..:..|:   |::|       |::|..|         :..||.:.
Human   128 KNNHTASILDRMQADFKCCGAANYTDW---EKIPSMSKNRVPDSCCIN---------VTVGCGIN 180

  Fly   175 FENYWQH-----------LTKIFNILALVLIGF---ELLLSVISCRLCNSIRN 213
            |.....|           |.|...::|...:|.   |:|..|.:|.|..|||:
Human   181 FNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 54/238 (23%)
tetraspanin_LEL 103..181 CDD:239401 16/87 (18%)
CD63NP_001244318.1 Tetraspannin 10..227 CDD:395265 52/231 (23%)
CD63_LEL 105..203 CDD:239419 20/110 (18%)
Lysosomal targeting motif. /evidence=ECO:0000250|UniProtKB:P41731 234..238 59/248 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.