DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and Tsp42Eb

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster


Alignment Length:214 Identity:59/214 - (27%)
Similarity:99/214 - (46%) Gaps:22/214 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LCTLLALVLISFGIYVAV--SYNLNEIGQLTAYG-----------YVGLGAAALLVVLWGYLSAW 68
            |..||.||.::.||.:.|  |..|:.:|..||:.           .:.:|:...:|..:|.....
  Fly    11 LLYLLNLVFVAGGILLIVVGSIMLSTMGNFTAFDGGVNTQTIPICIIVIGSVTFVVAFFGCCGTI 75

  Fly    69 RENVCCTVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLANALEATWEEELNSPG-AMSLYQNWF 132
            |||.|||..:.|.:.::...|.|:...:........|::..|::..|:|...:.| .|...|..|
  Fly    76 RENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSMGKAVDKAWDENNAAQGYPMDALQLAF 140

  Fly   133 QCCGRGSPQDYIVNERLPPETCFRNHDKSKP-ENLIHT---GCRVEFENYWQHLTKIFNILALVL 193
            .|||....|.|    ...|.:|....|::|. |..|::   |||.||.::|...|.:....:|::
  Fly   141 SCCGNTGYQQY----ETVPSSCCGYKDRTKVCEAEIYSQRPGCRQEFVDFWASNTDLIRWSSLII 201

  Fly   194 IGFELLLSVISCRLCNSIR 212
            ..|||.:.::||.|.:::|
  Fly   202 ALFELGIFIMSCCLASAMR 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 58/211 (27%)
tetraspanin_LEL 103..181 CDD:239401 25/82 (30%)
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 58/211 (27%)
tetraspanin_LEL 104..191 CDD:239401 25/90 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443003
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.