DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and tspan37

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001292501.1 Gene:tspan37 / 564334 ZFINID:ZDB-GENE-070912-550 Length:245 Species:Danio rerio


Alignment Length:208 Identity:43/208 - (20%)
Similarity:73/208 - (35%) Gaps:58/208 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GYVGLGAA---------------------ALLVVLWGYLSAWRENVCCTVT----------FIIF 81
            |..|||.:                     |||.|:.|.:.....::.|.|:          |:.|
Zfish    23 GITGLGGSFLLHKYRVYGLFFSNLYIIFPALLAVVSGAILFITGSIGCLVSSKKPSCGHGLFVYF 87

  Fly    82 LCLVIIAQFAVVYLLITQEKTVASNLANALEATWEEELNSPG----AMSLYQNWFQCCGRGSPQD 142
            |.:|.........|....:..:.:.||...:.......||..    |:...|:..||||..:..|
Zfish    88 LIIVFCVVGTTAALAYFYQGKLDAELAPLKDVFQNYSNNSQDPDTKAVDRLQSELQCCGVMNYTD 152

  Fly   143 YIVNERLP----------PETCFR------NHDKSKPENLIHTGCRVEFENYWQHLTKIFNILAL 191
            ::   :.|          |::|..      |.....|..|.:..|:|:.:.....:..|.:|.:|
Zfish   153 WL---QTPWFNHSGKYDVPQSCCNTTFHSCNGTLDAPMLLYNEACQVKLKELLLLVVHIIHITSL 214

  Fly   192 VLIGFELLLSVIS 204
            |:    |:|.|:|
Zfish   215 VV----LVLLVLS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 43/208 (21%)
tetraspanin_LEL 103..181 CDD:239401 19/97 (20%)
tspan37NP_001292501.1 Tetraspannin 14..194 CDD:278750 33/173 (19%)
TM4SF8_like_LEL 102..195 CDD:239416 17/95 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.