DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and Tsp97E

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster


Alignment Length:228 Identity:43/228 - (18%)
Similarity:89/228 - (39%) Gaps:60/228 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLIVYALDVLCTLLALVLISFGIY---VAVSYNLNEIGQLTAYGYVGLGAAALLVVLWGYLSAWR 69
            |..:.||::|..::..:||..|:|   .::..||..:|     |.:..|...:.:.:.|...|.:
  Fly     9 KNALIALNILYVMIGFLLIGVGVYARAASIVTNLPIVG-----GILACGVILICISMLGLAGAVK 68

  Fly    70 ENVCCTVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLANALEATWEEELNSPGAMSL------- 127
            .:......::|.|.::.:.||           ::||:.. |:.:..:::....|.|::       
  Fly    69 HHQVMLFFYMIILFMLFLIQF-----------SIASSCL-AVNSEQQQQFAEQGWMTVPTDLRKQ 121

  Fly   128 YQNWFQCCG--------------RGSPQDYIVNERLPPETCFRNHDKSKPENLIHTGCRVE---- 174
            .|:..:|||              ...|...::|:    :.|..:   |:|:      ||.|    
  Fly   122 VQDSLKCCGFNATAPSTTSVVPPSNEPSCELINQ----QCCAHS---SEPD------CRCEPCGP 173

  Fly   175 -FENYWQHLTKIFNILALVLIGFELLLSVISCR 206
             .|:...:..|:...|. :...|..:|:|...|
  Fly   174 LLEDKIDYAFKLCGGLG-IFFSFTEVLAVFLAR 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 43/228 (19%)
tetraspanin_LEL 103..181 CDD:239401 18/103 (17%)
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 42/225 (19%)
tetraspanin_LEL <121..177 CDD:243179 12/68 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442888
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.