DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and Tsp96F

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001262976.1 Gene:Tsp96F / 43127 FlyBaseID:FBgn0027865 Length:284 Species:Drosophila melanogaster


Alignment Length:263 Identity:55/263 - (20%)
Similarity:106/263 - (40%) Gaps:61/263 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSVKLIVYALDVLCTLLALVLISFGIY--------VAVSYNLNEIGQLTAYGYVGLGAAALLVVL 61
            |.||.::..:::|..|:.|.::...::        ::::.|.|.. .:..|.::.:|....|...
  Fly     8 SCVKYLMVLINILFWLIGLTIVVTSVWMLTDPTFMLSMTQNYNHY-HIALYVFLAIGILITLGAF 71

  Fly    62 WGYLSAWRENVCCTVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLANALEATWEEELNSPGAMS 126
            :|.....||:.|..|:|...:.:|::||.|........:..:...:..|::::.:||.......|
  Fly    72 FGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSS 136

  Fly   127 -------LYQNWFQCCGRGSPQDY------------IVNERLP--------PETCFRNHDKSK-- 162
                   |.:| .:|||...|.|:            ||...:.        ||:|.:::.|..  
  Fly   137 RTVTFDTLQKN-LKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESCCKDNLKDNEC 200

  Fly   163 ----------PEN--LIHTGC-----RVEFENYWQHLTKIFNILALVLIGFELLLSVISCRLCNS 210
                      |.|  :...||     .:.:||:    ..||.:.|.|:: .|||....:..||.:
  Fly   201 ELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENW----VTIFAVTAAVIL-LELLSLTFALSLCCA 260

  Fly   211 IRN 213
            :||
  Fly   261 VRN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 52/257 (20%)
tetraspanin_LEL 103..181 CDD:239401 23/123 (19%)
Tsp96FNP_001262976.1 Tetraspannin 9..261 CDD:278750 52/258 (20%)
CD151_like_LEL 107..233 CDD:239408 22/126 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443057
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.