DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and Tsp74F

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:234 Identity:59/234 - (25%)
Similarity:91/234 - (38%) Gaps:61/234 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IVYALDVLCTLLALVLISFGIYVAVSYNLNEIGQLTAYG---YVGLGAAAL--LVVLWGYLSAWR 69
            ||:.|    ||..||..||         :||:.....:.   ||.|..:.:  ||...|.:.|.:
  Fly    31 IVFCL----TLWTLVDRSF---------VNELLGTNLFSGAVYVLLVTSIIICLVSFLGCVGAGK 82

  Fly    70 ENVCCTVTFIIFLCLVIIAQ-FAVVYLLITQEKTVASNLANALEATWEEELNSPGAMSLY----- 128
            |..|..:|:.|.:.||.:.. ...|...:.:|:         ::.|..:|:.|  .|:||     
  Fly    83 EVKCLLLTYFIIVALVFVTMLIGGVLGYVFRER---------VQQTMRQEMRS--TMALYGSRRE 136

  Fly   129 --QNW------FQCCGRGSPQDYIVNERLP-PETC----FRNHDKS-----KPENLIHTGCRVEF 175
              |.|      .||||..:..|:  |...| ||:|    |....|.     ...||.:.||....
  Fly   137 ITQAWDLTQERLQCCGVDTWHDW--NRYGPVPESCCQELFGGQRKECTIFPTITNLYNQGCLYVT 199

  Fly   176 ENYWQHLTKIF---NILALVLIGFELLLSVISCRLCNSI 211
            .|:.:....:.   :|...:|:.|.:   :.||.|.|.|
  Fly   200 TNFIRDHAAVIGGTSIAVAILMIFGM---IFSCLLFNMI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 58/232 (25%)
tetraspanin_LEL 103..181 CDD:239401 25/100 (25%)
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 56/228 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.