DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and Tsp42Eq

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster


Alignment Length:223 Identity:48/223 - (21%)
Similarity:104/223 - (46%) Gaps:15/223 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TSSVKLIVYALDVLCTLLALVLISFGIYVAVSYNLNEIGQLTAYGYVGLGAAALLVVLWGYLSAW 68
            |.::|:..:.||.||.:||.:.|:...|..::::.:...::.:...:.||.......::|.::|.
  Fly     5 TKALKVSSFVLDFLCCVLAALTIAACSYALIAFSHSVAIRVPSILGIVLGGLLFFSTIFGCIAAL 69

  Fly    69 RENVCCTVTFIIFLCLVIIAQFAVV------YLLITQEKTVASNLANALEATWEEELNSPGAMSL 127
            ||::..|..:...|..::.:|..|:      |.|:..|         .:...|:.:|.....||.
  Fly    70 RESIRMTWIYAAILLALVFSQITVILAQPINYELLANE---------TIYDAWQGQLYHSDRMSY 125

  Fly   128 YQNWFQCCGRGSPQDYIVNERLPPETCFRNHDKSKPENLIHTGCRVEFENYWQHLTKIFNILALV 192
            ::..:.|||:..|.:|..:..:.|::|:.|.:.:...:|...||..:....:...|:...|....
  Fly   126 FEIKYHCCGQTGPANYPDSGLVIPQSCYFNQNATVTTDLYTVGCNHQLAAAFVKGTRWEKITDWS 190

  Fly   193 LIGFELLLSVISCRLCNSIRNDARRSYF 220
            ::|.|:|..:|:..|..:::|..||..:
  Fly   191 VVGVEILTVIIAGLLAITLQNAERRRLY 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 44/209 (21%)
tetraspanin_LEL 103..181 CDD:239401 15/77 (19%)
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 44/209 (21%)
tetraspanin_LEL 95..173 CDD:239401 18/86 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.