DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and Tsp42Ep

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001260759.1 Gene:Tsp42Ep / 35626 FlyBaseID:FBgn0033137 Length:250 Species:Drosophila melanogaster


Alignment Length:166 Identity:35/166 - (21%)
Similarity:65/166 - (39%) Gaps:13/166 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LGAAALLVVLWGYLSAWRENVCCTVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLANALEATWE 116
            ||.:..::|::|........:|..:.|.:|:.:.:.|::..::...:............||..|.
  Fly    53 LGGSICMIVMFGCYGMVANLLCVNLIFTMFILIALAAEYLQLHHYHSPSLRSPGGAWQQLELAWH 117

  Fly   117 EELNSPGAMSLYQNWFQCCGRGSPQDYIVNERLPPETCFRNHDKSKPENLIHTGCRVEF---ENY 178
            .....|..|..|:....|||.....||.....|.|.:|::.......:.:..:||....   :.|
  Fly   118 GLDRDPELMHQYEASQHCCGYNGADDYKRLHLLVPASCYQAAVNDTAQQIYPSGCLETLNRSQRY 182

  Fly   179 WQHLTKIFNILALVLIGFELL-------LSVISCRL 207
            .||..|::   ...::|.|:.       |||:..||
  Fly   183 IQHRDKLY---MWAIVGLEIFILLQTVALSVLLFRL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 35/166 (21%)
tetraspanin_LEL 103..181 CDD:239401 17/80 (21%)
Tsp42EpNP_001260759.1 Tetraspannin <51..213 CDD:278750 33/162 (20%)
tetraspanin_LEL 91..183 CDD:239401 16/91 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443035
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.