DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and Tsp42El

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster


Alignment Length:222 Identity:57/222 - (25%)
Similarity:99/222 - (44%) Gaps:18/222 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 STSSVKLIVYALDVLCTLLALVLISFGIYVAVSYNLNEIGQLTAYGYVGLGAAALLVVLWGYLSA 67
            :|.::|..::..:.|..:|.::::.||     ......:....|.|.:.||...|::.|:|...|
  Fly     4 ATGTIKYSLFLFNALWAILGILVLIFG-----GLGWGAMPDAYAIGILILGGTILVISLFGCCGA 63

  Fly    68 WREN--VCCTVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLA-NALEATWEEELNSPGAMSLYQ 129
            .||:  :..|...::.:.|::|..|     :|...|.|....| ..:|..||.|...||:|.:.|
  Fly    64 VRESPRMLWTYASLLLILLLLIVAF-----IILNPKDVFKKYALQTVENQWELEQTKPGSMDIIQ 123

  Fly   130 NWFQCCGRGSPQDYI----VNERLPPETCFRNHDKSKPENLIHTGCRVEFENYWQHLTKIFNILA 190
            ..:.||||.|.|||:    .|..: |.:|.::.....|.||...||.::.|..:.........|.
  Fly   124 KTYYCCGRDSAQDYLDIKFWNNTV-PSSCCKDDSCVNPLNLYVRGCLIKVEEAFADEATTLGYLE 187

  Fly   191 LVLIGFELLLSVISCRLCNSIRNDARR 217
            ..|:||..::.:::..|.....|..||
  Fly   188 WGLLGFNAVILLLAIILAIHYTNRRRR 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 53/210 (25%)
tetraspanin_LEL 103..181 CDD:239401 27/82 (33%)
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 52/199 (26%)
tetraspanin_LEL 94..178 CDD:239401 28/84 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443031
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.