DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and Tsp42Ek

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001246161.1 Gene:Tsp42Ek / 35621 FlyBaseID:FBgn0033133 Length:215 Species:Drosophila melanogaster


Alignment Length:236 Identity:68/236 - (28%)
Similarity:99/236 - (41%) Gaps:43/236 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASTSS-VKLIVYALDVLCTLLALVLISFG---------IYVAVSYNLNEIGQLTAYGYVGLGAA 55
            |..||. ||..:..|:.|..|..|.||:..         .|:...|              |||..
  Fly     1 MGCTSGCVKCFLNTLNTLNALSGLSLIAIATLALSKAPIAYILFLY--------------GLGGI 51

  Fly    56 ALLVVLWGYLSAWRENVCCTVTF-IIFLCLVIIAQFAVVYLLITQEKTVASNLANALEATWEEEL 119
            ..:..:.|......||||.|.|: .:.|..:||:...:.....|:| .:....|..::..|:|||
  Fly    52 IFVSAVLGCCGICMENVCMTATYGFLLLAQLIISLLGIFRFKFTEE-YIEKFAAEEVQMKWDEEL 115

  Fly   120 NSPGAMSLYQNWFQCCGRGSPQDYIV--NERLPPETCFRNHDKSKPENLIHTGC-RVEFENY--- 178
            ..||||.:||..::||||.||.||:.  .:.||| :|:...|...|..|  .|| :...||:   
  Fly   116 VEPGAMDIYQTVYECCGRDSPDDYVAIGRQTLPP-SCYPQEDPQMPHYL--AGCVQKSSENFVVL 177

  Fly   179 --WQHLTKIFNILALVLIGFELLLSVISCRLCNSIRNDARR 217
              :.|.|   |.:||   |..:|:.:.:..|....|....|
  Fly   178 FSYAHDT---NWIAL---GITILMMIAAFYLVGRFRKQRVR 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 63/221 (29%)
tetraspanin_LEL 103..181 CDD:239401 30/85 (35%)
Tsp42EkNP_001246161.1 Tetraspannin 7..202 CDD:278750 62/218 (28%)
tetraspanin_LEL 94..174 CDD:239401 31/83 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.