DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and Tsp42Ej

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster


Alignment Length:195 Identity:47/195 - (24%)
Similarity:80/195 - (41%) Gaps:17/195 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YALDVLCTLLALVLISFGIYVAVSYNLNEIGQLTAYGYVGLGAAALLVVLWGYLSAWRENVCCTV 76
            |.|.|.|.|:....:.|......::. :.:....:||....|.|...|...|...|.:.:...::
  Fly    12 YGLLVTCILIVTCNVFFFSCGVTTWG-SAVSVYGSYGSALCGGAVFGVAFLGMYVALKVSYKYSI 75

  Fly    77 TFIIFLCLVIIAQFAVVYLLITQEKTVASNLANALEATWEEELNSPGAMSLYQNWFQCCGRGSPQ 141
            .::|...|||.|..:.::......:.:.......:...:|.:.:|...|....:.|.|||...||
  Fly    76 YYLICSGLVIAALGSYLFTFTAMREQLMGRFEERMRDLFERKTHSDDKMQPVHSLFGCCGIEGPQ 140

  Fly   142 DYIVNER--LPPETCFRNHDKSKPENLIHTGC--------RVEFE-NYWQHLTKIFNILALVLIG 195
            ||:..|.  ||...|:. .|.|||.::...||        |::.| ||:..:.    |:||..:|
  Fly   141 DYLQEEHGALPSSCCYA-FDCSKPAHVYEEGCSTKAVATLRMQAELNYYSCMA----IIALEFLG 200

  Fly   196  195
              Fly   201  200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 47/195 (24%)
tetraspanin_LEL 103..181 CDD:239401 25/88 (28%)
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 47/195 (24%)
tetraspanin_LEL 97..183 CDD:239401 22/86 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.