DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and Tsp42Eh

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster


Alignment Length:228 Identity:66/228 - (28%)
Similarity:113/228 - (49%) Gaps:15/228 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SVKLIVYALDV---LCTLLALVLISFGIYV--AVSYNLNEIG-----QLTAYGYVGLGAAALLVV 60
            :.:|:.|.|.|   :|.|...:||.:|.::  ::|.....:|     .|.|...|.||...::..
  Fly     4 TTRLLRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGEDLAAVLCVLLGTVIVVAS 68

  Fly    61 LWGYLSAWREN---VCCTVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLANALEATWEEELNSP 122
            ::|.::..:::   :.|....::||.:|.|...::.|  ......:..:|...|:..|:.:....
  Fly    69 IFGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISY--AASRDFLPDSLRQGLDDLWDLQHEGN 131

  Fly   123 GAMSLYQNWFQCCGRGSPQDYIVNERLPPETCFRNHDKSKPENLIHTGCRVEFENYWQHLTKIFN 187
            ..::.|:.|..||||.|.:||:..|::||.:|..|.|.:|..||..|||.|:|:.|....|..|:
  Fly   132 STLNTYEEWLHCCGRNSAEDYLHLEKMPPPSCCLNRDCTKHLNLFMTGCEVKFKEYVGAKTANFH 196

  Fly   188 ILALVLIGFELLLSVISCRLCNSIRNDARRSYF 220
            .|:..|:.||...||.:|.|.:||||...|..|
  Fly   197 SLSWFLVIFEFAGSVTTCYLVDSIRNHRDRIRF 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 60/216 (28%)
tetraspanin_LEL 103..181 CDD:239401 27/77 (35%)
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 59/213 (28%)
tetraspanin_LEL 109..192 CDD:239401 27/82 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443023
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570819at33208
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.