DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and Tsp42Ec

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster


Alignment Length:237 Identity:52/237 - (21%)
Similarity:96/237 - (40%) Gaps:37/237 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VKLIVYALDVLCTLLALVLISFGIYVAVSYNLNEIGQLTAYG-----------YVGLGAAALLVV 60
            |..|:|.::::..::.::||..|     |..|:::.:....|           ...||....:|.
  Fly     8 VNFILYIVNIVFLIVGILLIVLG-----SIMLSDLSRFDVAGSGTDPNTIPICVTVLGGLIFVVS 67

  Fly    61 LWGYLSAWRENVCCTVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLANALEATWEEELNSPGAM 125
            .:|....:|::||.|..:...:.::.|.|..:...:.........:::|.:...|:.  :...||
  Fly    68 FFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSAFLGDMSNLVNLLWDS--HDYTAM 130

  Fly   126 SLYQNWFQCCGRGSPQDYIVNERLPPETCFRNHDK-----------SKPENLIHTGCRVEFENYW 179
            .:.:..|.|||..|..:|.......|.||....|:           |:|      ||..:||.:|
  Fly   131 GVLEETFGCCGDTSYTNYNNIGLSVPGTCCGYLDRQATCNTPSVYQSRP------GCSAKFEEFW 189

  Fly   180 QHLTKIFNILALVLIGFELLLSVISCRLCNSIR--NDARRSY 219
            .....|.....|.|..|:|::.:|:..|.|.:|  |..|:.|
  Fly   190 NDNMDIIRWSGLGLCIFDLVVFLIAGALTNCMRSQNAGRQVY 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 48/225 (21%)
tetraspanin_LEL 103..181 CDD:239401 21/88 (24%)
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 48/225 (21%)
tetraspanin_LEL 104..193 CDD:239401 21/96 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443007
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.