DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and Tsp29Fb

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001137809.1 Gene:Tsp29Fb / 34212 FlyBaseID:FBgn0032075 Length:308 Species:Drosophila melanogaster


Alignment Length:271 Identity:56/271 - (20%)
Similarity:104/271 - (38%) Gaps:81/271 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSVKLIVYALDV---LCTLLALVLISFG-----------------------IYVAVSYNLNEIGQ 43
            |.:|...|.|.:   :..|.|::||..|                       :.:|:.:.|..:..
  Fly    10 SGMKCAKYMLIIVSFMFALTAILLIMVGTTIQTIFGDFSLFIDGHFSSPPALLIAIGFILIAVAA 74

  Fly    44 LTAYGYVGLGAAALLVVLWGYLSAWRENVCCTVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLA 108
            |.|||.|  ..:.:::.|:|        ||..:.||:.:...|.|     :::.:|.:.:.....
  Fly    75 LGAYGAV--KESVMVINLYG--------VCLFLVFILEVSAAIAA-----FVMQSQVRGMLIRTM 124

  Fly   109 NALEATWEEELNSPGAMSLYQNWFQCCGRGSPQ---DYI---------VNERLPPETCFRNHDKS 161
            |...|.:|.:......:...|:..:|||...|:   ||:         |::.:.|.:|..|...|
  Fly   125 NQALAEYEHDPYVESGVDFMQSMLECCGVNEPEDWKDYLSANVNFTLGVDDVVVPNSCCGNQPTS 189

  Fly   162 KPENLIHT-------GCRVEFENYWQHLTKIFNILALVL------IGFELLLSVI-------SCR 206
            ..::...|       ||       ::.:..|.:..|:::      :.|..||.|:       :.|
  Fly   190 LNDSTQMTCMETYDYGC-------FRKMNFIVSQSAMLIATGATTVAFVQLLGVLCAFMLAKTLR 247

  Fly   207 LCNSIRNDARR 217
            ...||| :|||
  Fly   248 RNKSIR-EARR 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 49/261 (19%)
tetraspanin_LEL 103..181 CDD:239401 18/96 (19%)
Tsp29FbNP_001137809.1 Tetraspannin 14..246 CDD:278750 47/253 (19%)
tetraspanin_LEL 110..218 CDD:239401 20/114 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.