DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and cd63

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_955837.1 Gene:cd63 / 321461 ZFINID:ZDB-GENE-030131-180 Length:237 Species:Danio rerio


Alignment Length:231 Identity:63/231 - (27%)
Similarity:101/231 - (43%) Gaps:32/231 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VKLIVYALDVLCTLLALVLISFGIYVAVSYNLNEIGQLTAYG----YVGLGAAALLVVLWGYLSA 67
            ||.:::..:.:..|..|.||..||.|.||.:...|.| .|.|    .:.:|.....:..:|...|
Zfish    10 VKYLLFFFNFIFWLCGLALIVLGILVHVSLHNTAILQ-GASGSPMVLIVVGVIIFFISFFGCCGA 73

  Fly    68 WRENVCCTVTFIIFLCLVIIAQFA---VVYLLITQEKTVASNLANALEATWEEELNSPGAMSLYQ 129
            |:||.|..|||.|.|.|::|.:..   ..|:...:...:.....|.:.|.:.:.......:...|
Zfish    74 WKENQCMVVTFAIILSLIVITEIGAGIAGYIFRGKVNELLDQSFNTMIAGYNKTEEYRTTLDSIQ 138

  Fly   130 NWFQCCGRGSPQDYI---VNERLPPETCFRNHDK-------SKPENLIHTGCRVEFENYWQHLTK 184
            ...:|||..|..|::   .:....|::|.:|..|       :||..:...||:...|      |:
Zfish   139 KQLKCCGGNSSSDWVNFSADHISVPDSCCKNVTKNCGIGAMTKPTVIYLEGCQPILE------TR 197

  Fly   185 I-FNIL-----ALVLIGF-ELLLSVISCRLCNSIRN 213
            | .|||     ||| ||| ::...|::|.|..:||:
Zfish   198 IKENILWIAVGALV-IGFVQITGIVLACILSRAIRS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 61/227 (27%)
tetraspanin_LEL 103..181 CDD:239401 17/87 (20%)
cd63NP_955837.1 Tetraspannin 9..230 CDD:278750 61/227 (27%)
CD63_LEL 103..202 CDD:239419 20/104 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.