DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and Tsp2A

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster


Alignment Length:232 Identity:48/232 - (20%)
Similarity:93/232 - (40%) Gaps:31/232 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VKLIVYALDVLCTLLALVLISFGIYVAVSYNLNE-----------IGQLTAYGYVGLGAAALLVV 60
            ||..::..:::..:::..|.:..:::......|:           ||   .|..:|:....:.|.
  Fly    19 VKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQSFYIG---VYVLIGISIVMMAVS 80

  Fly    61 LWGYLSAWRENVCCTVTFI---IFLCLVIIAQFAVVYLLITQEKTVASNLANALEAT------WE 116
            ..|.|||..||......|:   :|..:.|:|..||    :.|..|:.|:|...|..:      ..
  Fly    81 FLGCLSALMENTLALFVFVGTQVFGFIAIVAGSAV----LLQFSTINSSLQPLLNVSLRGFVATS 141

  Fly   117 EELNSPGAMSLYQNWFQCCGRGSPQDYIVNERLPPETCFRNHDKSKPENLIHTGCRVEFENYWQH 181
            |...|...:::.|....|||...|.||:...:..|.:|    ..:...|....||..|...:::.
  Fly   142 EYTYSNYVLTMIQENIGCCGATGPWDYLDLRQPLPSSC----RDTVSGNAFFNGCVDELTWFFEG 202

  Fly   182 LTKIFNILALVLIGFELLLSVISCRLCNSIRNDARRS 218
            .|.....||:.|....::.:|:|..|..:::.:..::
  Fly   203 KTGWIVALAMTLGLLNVICAVMSFVLVQAVKKEEEQA 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 48/223 (22%)
tetraspanin_LEL 103..181 CDD:239401 18/83 (22%)
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 48/223 (22%)
tetraspanin_LEL 116..204 CDD:239401 20/91 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.