DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and Tspan3

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001005547.1 Gene:Tspan3 / 300733 RGDID:1359444 Length:253 Species:Rattus norvegicus


Alignment Length:239 Identity:55/239 - (23%)
Similarity:93/239 - (38%) Gaps:30/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TSSVKLIVY-------ALDVLCTLLALVLISFGIYVAVSYNLNEIGQL-TAYGYVGLGAAALLVV 60
            |||..::|:       |..:||.:.|.|.|::..|   .:...::..| .|...:.:||...::.
  Rat     7 TSSKTVLVFLNLIFWGAAGILCYVGAYVFITYDDY---DHFFEDVYTLFPAVVIMAVGALLFIIG 68

  Fly    61 LWGYLSAWRENVCCTVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLANALEATWE--EELNSPG 123
            |.|..:..||:.|...||:..|.||.:.:..||.|.......|.:.:..:::..::  ...||..
  Rat    69 LIGCCATIRESRCGLATFVFILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQKVYKTYNGTNSDA 133

  Fly   124 ---AMSLYQNWFQCCGRGSPQDY--------IVNERLPPETCFR-----NHDKSKPENLIHTGCR 172
               |:...|....|||..:..|:        ..|:.:|...|..     |...:.|.:|...||.
  Rat   134 ASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETARSCNGSLANPSDLYAEGCE 198

  Fly   173 VEFENYWQHLTKIFNILALVLIGFELLLSVISC-RLCNSIRNDA 215
            .......|.:.......||.....:||..:.:| .||...|:.|
  Rat   199 ALVVKKLQEILMHVIWAALAFAAIQLLGMLCACIVLCRRSRDPA 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 50/230 (22%)
tetraspanin_LEL 103..181 CDD:239401 17/95 (18%)
Tspan3NP_001005547.1 Tetraspannin 10..237 CDD:278750 50/229 (22%)
TM4SF8_like_LEL 104..210 CDD:239416 18/105 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.