DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and Cd63

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_008763246.1 Gene:Cd63 / 29186 RGDID:62080 Length:262 Species:Rattus norvegicus


Alignment Length:235 Identity:67/235 - (28%)
Similarity:103/235 - (43%) Gaps:39/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VKLIVYALDVLCTLLALVLISFGIYV------AVSYNLNEIGQLTAYGYVGLGAAALLVVLWGYL 65
            ||.::|.|.:.....|:.||:.|:.|      |:::. ...|.|.....:.:||...||...|..
  Rat    34 VKFLLYVLLLAFCACAVGLIAIGVAVQVVLKQAITHE-TTAGSLLPVVIIAVGAFLFLVAFVGCC 97

  Fly    66 SAWRENVCCTVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLANALEATWEEELNSPGAMSL--- 127
            .|.:||.|..:||.|||.|:::.:.||..........|.|..:.:.:...:..|......::   
  Rat    98 GACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFSKSFQKQMQNYLTDNKTATILDK 162

  Fly   128 YQNWFQCCGRGSPQDYIVNERLP-------PETCFRN------HDKSKPENLIHT-GCRVEFENY 178
            .|...:|||..:..|:   ||:|       |::|..|      :|..  |:.||| || ||....
  Rat   163 LQKENKCCGASNYTDW---ERIPGMAKDRVPDSCCINITVGCGNDFK--ESTIHTQGC-VETIAA 221

  Fly   179 WQHLTKIFNIL-----ALVLIGFELLLSVISCRLCNSIRN 213
            |  |.|  |:|     ||.:...|:|..:.||.|..|||:
  Rat   222 W--LRK--NVLLVAGAALGIAFVEVLGIIFSCCLVKSIRS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 64/231 (28%)
tetraspanin_LEL 103..181 CDD:239401 24/94 (26%)
Cd63XP_008763246.1 Tetraspannin 33..255 CDD:278750 64/231 (28%)
ATP-synt_A <72..131 CDD:294288 19/58 (33%)
CD63_LEL 129..227 CDD:239419 26/107 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.