DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and tsp-5

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_502621.3 Gene:tsp-5 / 192061 WormBaseID:WBGene00006631 Length:241 Species:Caenorhabditis elegans


Alignment Length:232 Identity:48/232 - (20%)
Similarity:92/232 - (39%) Gaps:53/232 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SVKLIVYALDVLCTLLALV-LIS------FGIYVAVSYNLNEIGQLTAYGYVGLGAAALLVVLWG 63
            |:.::::..:|.....:|| |:|      |.:|..:|..:.  |.:...|:.|..|.       |
 Worm    32 SIWMVLHQFEVTVARTSLVNLLSVDNIECFYVYRTISIMIG--GCMVVLGFCGCFAV-------G 87

  Fly    64 YLSAWRENVCCTVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLANALEATWEEEL------NSP 122
            :.|....:|...:.||:|:..::    |:|..|...:     :|.......:.:||      ||.
 Worm    88 FGSKTALSVHLVLVFIVFVVKIV----AIVMFLANND-----HLRREFVGVYRDELVANYHNNSR 143

  Fly   123 GAMSLYQNW----FQCCGRGSPQDYIVNERLP----PETCFRNHDKSKPENLI--HTGCRVEFEN 177
            ...:|  :|    .:|||....:|:     ||    |.:|     :...:|.:  ..||.:....
 Worm   144 TKNTL--DWVHTSLKCCGANGCEDF-----LPAGNFPTSC-----ECGTKNAVVRMEGCALITWA 196

  Fly   178 YWQHLTKIFNILALVLIGFELLLSVISCRLCNSIRND 214
            .::..|.....|.|:.:..||.|.:.:..:.:.||.:
 Worm   197 VFEDGTLQVAFLGLICMLIELGLMIFAAIVIDRIRRE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 45/226 (20%)
tetraspanin_LEL 103..181 CDD:239401 18/93 (19%)
tsp-5NP_502621.3 Tetraspannin 11..223 CDD:278750 46/220 (21%)
tetraspanin_LEL 116..191 CDD:239401 18/91 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.