DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and tsp-8

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_510445.1 Gene:tsp-8 / 181567 WormBaseID:WBGene00006634 Length:282 Species:Caenorhabditis elegans


Alignment Length:273 Identity:63/273 - (23%)
Similarity:109/273 - (39%) Gaps:73/273 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSVKLIVYALDVLCTLLALVLISFGIYVAVSYNLNEIGQL-----TAYGYVG---LGAAALLVVL 61
            ::::::.:..:....|..:|:...||::......::...|     .|:.|||   :||.|:::::
 Worm     6 NALRIVTFLFNFAFWLSGVVVFGLGIWLLFDPAASDFFALHSTHPGAFRYVGWFLVGAGAIIILV 70

  Fly    62 --WGYLSAWRENVCCTVTFIIFLCLVIIAQF----AVVYLLITQEKT---VASNLANALEATWEE 117
              :|.:.||:.|.|   ....|.|::|:|.|    |.|.|...||..   |.|::.:.:...:..
 Worm    71 GYFGCIGAWKMNQC---ALAFFCCILILAFFLELAAAVTLFHKQEHIKHYVESSMYDTIRNRYSS 132

  Fly   118 ELNSPGAMSLYQNWFQCCGRGSPQDYI-------------VNE----RLP--------------- 150
            |.....|....|..|:|||..:..|::             |||    |:.               
 Worm   133 ETAFKDAFDTVQEKFECCGVKTYTDWLSARWDAEPSTQLEVNEEDAGRIEHGIGAFGGNKGTGYG 197

  Fly   151 --PETCFRNHDK-SKPEN---------------LIHT-GCR-VEFENYWQHLTKIFNILALVLIG 195
              |.:|...|.| |.|.|               .|:| ||. ..:|:....|:.|..: .:||..
 Worm   198 RVPSSCCNEHGKLSYPNNCGRSFSQAPLNTYAQFINTRGCADAVYESVSSSLSLIVGV-CVVLCI 261

  Fly   196 FELLLSVISCRLC 208
            .:||..|:|..||
 Worm   262 VQLLGIVLSMTLC 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 63/271 (23%)
tetraspanin_LEL 103..181 CDD:239401 26/129 (20%)
tsp-8NP_510445.1 Tetraspannin 8..276 CDD:278750 63/271 (23%)
Heme_Cu_Oxidase_I 13..>108 CDD:294196 24/97 (25%)
tetraspanin_LEL 108..243 CDD:239401 27/134 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.