DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and tsp-6

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001294830.1 Gene:tsp-6 / 13219712 WormBaseID:WBGene00006632 Length:237 Species:Caenorhabditis elegans


Alignment Length:245 Identity:53/245 - (21%)
Similarity:100/245 - (40%) Gaps:52/245 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VKLIVYALDVLCTLLALVLISFGIYVAVSYN-LN-----------------EIGQLTAYGYVG-- 51
            ||...:.::.|..:|..:::...|::.|..| ||                 .|.||.::.||.  
 Worm    10 VKYFFWLINFLFFVLGAIIVGLSIWMLVDKNSLNTVASTVKVDLSQILSQVNIQQLNSFLYVAIV 74

  Fly    52 LGAAALLVVLWGYLSAWRENVCC-TVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLANALEATW 115
            :|.|.|::..:|...:..|::|. ::.||:.|.|.::...|:|...:.:     :||....:..|
 Worm    75 IGGALLVLGFFGCCGSCCESICAISIYFILVLILFVVEVVAIVLYFVNK-----TNLQQGFQTIW 134

  Fly   116 EEELNSP--------GAMSLYQNWFQCCGRGSPQDYIVNERLP----PETCFRNHDKSKPENLIH 168
            .:||.|.        ..:...|:..||||.....|||     |    |.:|       :...:..
 Worm   135 RDELVSKYNTQQQIHQVLDQIQSSLQCCGASGCSDYI-----PYGAFPTSC-------QCATIQQ 187

  Fly   169 TGCRVEFENYWQHLTKIFNILALVLIGFELLLSVISCRLCNSIRNDARRS 218
            .||.....|.::........:.::::..|||..:.||.:..:::.  :||
 Worm   188 AGCATVIWNSFESSLIYVAFVGIIILFVELLAMIFSCIIIGAVKE--KRS 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 51/236 (22%)
tetraspanin_LEL 103..181 CDD:239401 20/89 (22%)
tsp-6NP_001294830.1 Tetraspannin 9..227 CDD:278750 51/233 (22%)
tetraspanin_LEL 120..202 CDD:239401 20/98 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.