DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and Tsp68C

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster


Alignment Length:275 Identity:64/275 - (23%)
Similarity:101/275 - (36%) Gaps:79/275 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASTSSVKLIVYALDVLCTLLALVLISFGIYV--------------AVSYNLNEIGQ-LTAYGYV 50
            ||...:.|.::...:.|..:..|:|:..|:|:              |.|..|:.:.| |..|..:
  Fly     1 MACCFNYKFVLNLCNFLFLICGLLLVVSGLYIFSDNKRILLSRLLAASSDRLSSLPQPLLFYIAL 65

  Fly    51 GLGAAALLVVLWGYLSAWRENVCCTVTFIIFLCLVIIAQFAVVYLLITQ---------------- 99
            |:..|..:..|...:..|   ..|..|:    |.:.|...:||.||:|:                
  Fly    66 GVAIAGFVATLAAVVGFW---ASCLHTY----CFLTIYFLSVVVLLLTESVLCLAITLWPHCLGI 123

  Fly   100 ---EKTVASNLANALEATWEEELNSPGAMSLYQNWFQCCGRGSPQDYIV-----------NERLP 150
               |..:..:|.:......:|:..:  |:.|.|..|.|||..|..||..           |..:|
  Fly   124 SLDETQMVRSLQSNYGVPGQEQFTN--ALDLAQVRFGCCGMRSSLDYDTSLWRLQGYGQRNWPVP 186

  Fly   151 PETCF-RNHDKS------KPENLI--------------HT-GCRVEFENYWQHLTKIF--NILAL 191
            ...|| :|...|      ||.|..              || .|....:|:::....||  ..|.|
  Fly   187 LSCCFLKNAGHSMAYLDPKPANESMCQSLERLSYERERHTESCLPHLDNWYREQYSIFLGASLIL 251

  Fly   192 VLIGFELLLSVI-SC 205
            .:|.|.:||::| ||
  Fly   252 AMIEFCVLLAIIMSC 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 62/269 (23%)
tetraspanin_LEL 103..181 CDD:239401 25/110 (23%)
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 62/268 (23%)
tetraspanin_LEL 117..241 CDD:239401 26/125 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.