DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ef and TSPAN3

DIOPT Version :9

Sequence 1:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_005715.1 Gene:TSPAN3 / 10099 HGNCID:17752 Length:253 Species:Homo sapiens


Alignment Length:241 Identity:57/241 - (23%)
Similarity:93/241 - (38%) Gaps:34/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TSSVKLIVY-------ALDVLCTLLALVLISFGIY---VAVSYNLNEIGQLTAYGYVGLGAAALL 58
            |||..::|:       |..:||.:.|.|.|::..|   ....|.|     :.|...:.:||...:
Human     7 TSSKTVLVFLNLIFWGAAGILCYVGAYVFITYDDYDHFFEDVYTL-----IPAVVIIAVGALLFI 66

  Fly    59 VVLWGYLSAWRENVCCTVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLANALEATWEE-ELNSP 122
            :.|.|..:..||:.|...||:|.|.||.:.:..||.|.......|.:.:..:::..::. ...:|
Human    67 IGLIGCCATIRESRCGLATFVIILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQKVYKTYNGTNP 131

  Fly   123 GAMS----LYQNWFQCCGRGSPQDY--------IVNERLPPETCFR-----NHDKSKPENLIHTG 170
            .|.|    ..|....|||..:..|:        ..|:.:|...|..     |...:.|.:|...|
Human   132 DAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNGSLAHPSDLYAEG 196

  Fly   171 CRVEFENYWQHLTKIFNILALVLIGFELLLSVISC-RLCNSIRNDA 215
            |........|.:.......||.....:||..:.:| .||...|:.|
Human   197 CEALVVKKLQEIMMHVIWAALAFAAIQLLGMLCACIVLCRRSRDPA 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 52/232 (22%)
tetraspanin_LEL 103..181 CDD:239401 17/95 (18%)
TSPAN3NP_005715.1 Tetraspannin 9..232 CDD:395265 50/227 (22%)
TM4SF8_like_LEL 104..210 CDD:239416 18/105 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.