DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and CD81

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_004347.1 Gene:CD81 / 975 HGNCID:1701 Length:236 Species:Homo sapiens


Alignment Length:247 Identity:65/247 - (26%)
Similarity:117/247 - (47%) Gaps:51/247 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TSMVKYILFIFNTIVSVIGILGIVYGVLI-------LKSIGVVEVNGQ-------VGFPIQALMP 55
            |..:||:||:||.:..:.|  |::.||.:       ..::..:|:..:       ||.       
Human     7 TKCIKYLLFVFNFVFWLAG--GVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGI------- 62

  Fly    56 IILISLGSIVVFISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHREE--------F 112
            .|||::|::::|:.||||.|||:||.|:..::.|.|:||...::...:..|.::::        :
Human    63 YILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFY 127

  Fly   113 ENAMGNVI--ENAWNSEHTYKGGVFDTIQKSLHCCGSSSALDYIGKGDLVPPSCCSGSCLIPTNY 175
            :.|:...:  ::|.|::     .|..|..::|.|||||: |..:....|....|.|||.:|...:
Human   128 DQALQQAVVDDDANNAK-----AVVKTFHETLDCCGSST-LTALTTSVLKNNLCPSGSNIISNLF 186

  Fly   176 YPGCRGKFVELMTTGSDNAKYVGIGLIGI------ELIGFIFACCLANNVRN 221
            ...|..|..:|.   |.....:||..|.:      |:|..:..||   .:||
Human   187 KEDCHQKIDDLF---SGKLYLIGIAAIVVAVIMIFEMILSMVLCC---GIRN 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 62/240 (26%)
tetraspanin_LEL 106..187 CDD:239401 21/90 (23%)
CD81NP_004347.1 Tetraspannin 10..226 CDD:395265 60/233 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.