DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and CD63

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001244318.1 Gene:CD63 / 967 HGNCID:1692 Length:238 Species:Homo sapiens


Alignment Length:243 Identity:58/243 - (23%)
Similarity:119/243 - (48%) Gaps:40/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTSMVKYILFI--FNTIVSVIGILGIVYGVLILKSIGVVEVNGQVGFPIQALMPIILISLGSIVV 66
            |...||::|::  .......:|::.:..|..::.|..:::     |....:|:|:::|::|..:.
Human     6 GMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQ-----GATPGSLLPVVIIAVGVFLF 65

  Fly    67 FISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHRE----EFENAMGNVIENAWNSE 127
            .::|:|||||.:|:.|:.:::|.||.:::::::...:..:..|:    ||.|.....:||...:.
Human    66 LVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNN 130

  Fly   128 HTYKGGVFDTIQKSLHCCGSSSALDY-----IGKGDLVPPSCCSGSCLIPTNYYPGCRGKFVELM 187
            ||  ..:.|.:|....|||:::..|:     :.| :.||.|||       .|...||...|.|..
Human   131 HT--ASILDRMQADFKCCGAANYTDWEKIPSMSK-NRVPDSCC-------INVTVGCGINFNEKA 185

  Fly   188 TTGSDNAKYVG--------------IGLIGIELIGFIFACCLANNVRN 221
            .......:.:|              :|:..:|::|.:|||||..::|:
Human   186 IHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 56/235 (24%)
tetraspanin_LEL 106..187 CDD:239401 25/89 (28%)
CD63NP_001244318.1 Tetraspannin 10..227 CDD:395265 54/231 (23%)
CD63_LEL 105..203 CDD:239419 26/107 (24%)
Lysosomal targeting motif. /evidence=ECO:0000250|UniProtKB:P41731 234..238 58/243 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.