DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and Tspan2

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_072111.1 Gene:Tspan2 / 64521 RGDID:620982 Length:221 Species:Rattus norvegicus


Alignment Length:235 Identity:60/235 - (25%)
Similarity:104/235 - (44%) Gaps:39/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTSMVKYILFIFNTIVSVIGILGIVYGVLI-----LKSIGVVEVNGQ---VGFPIQALMPIILIS 60
            |...:||:|..||.:..:.|...|.:|:..     :|.:...|.:.:   ||.       .:|:.
  Rat     7 GLRCIKYLLLGFNLLFWLAGSAVIAFGLWFRFGGTIKDLSSEEKSPEYFYVGL-------YVLVG 64

  Fly    61 LGSIVVFISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHREEFENAMGNVIENAWN 125
            .|::::.:.|.|||||:|||.|:..|:.|.||::...::|..|..|..::.....:.::.|.|::
  Rat    65 AGALMMAVGFFGCCGAMRESQCVLGSFFTCLLVIFAAEVTTGVFAFIGKDVAIRHVQSMYEEAYS 129

  Fly   126 SEHTYKG---GVFDTIQKSLHCCGSSSALDYIGKGDLVPPSCCSGSCLIPTNYYPG---CRGKFV 184
            .....:|   |...|...:..|||..|:       :.|.|:|        ....||   |..|..
  Rat   130 DYVRDRGRGNGTLITFHSAFQCCGKESS-------EQVQPTC--------PKELPGHKNCIDKIE 179

  Fly   185 ELMTTGSDNAKYVGIGLIGIELIGFIFA---CCLANNVRN 221
            .:::........||||:.|:.:.|.||:   ||...|.|:
  Rat   180 TIISVKLQLIGIVGIGIAGLTIFGMIFSMVLCCAIRNSRD 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 57/227 (25%)
tetraspanin_LEL 106..187 CDD:239401 17/86 (20%)
Tspan2NP_072111.1 Tetraspannin 10..214 CDD:278750 57/225 (25%)
CD81_like_LEL 110..186 CDD:239404 17/90 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.