DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and Tsp42Ea

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster


Alignment Length:234 Identity:107/234 - (45%)
Similarity:146/234 - (62%) Gaps:14/234 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCGTSMVKYILFIFNTIVSVIGILGIVYGVLILKSIGVVEVNGQVGFPIQAL----MPIILISL 61
            |.||.|||||||||||.:.|:.|||.||:|.|:..     :|.....| .:||    :|:.:|.|
  Fly     1 MSCGISMVKYILFIFNLLCSICGILLIVFGALLFS-----KVRNMDDF-AEALRTQQVPVTMIIL 59

  Fly    62 GSIVVFISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHREEFENAMGNVIENAWNS 126
            |:|::.||:.|||||||||.||:|:|:..|.:|:|.||..|:.::..::::...||:|:|.||| 
  Fly    60 GTIILLISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKAWN- 123

  Fly   127 EHTYKGGVFDTIQKSLHCCGSSSALDYIGKGDLVPPSCCS--GSCLIPTNYYPGCRGKFVELMTT 189
            ..|.:....|.||.|:.|||.|...||..:|.. ||||||  .:|...|.|..||:..|||....
  Fly   124 HRTSRSDYMDAIQISMKCCGRSGYTDYAYQGKF-PPSCCSDTNNCRWETVYRRGCKVTFVEFWDR 187

  Fly   190 GSDNAKYVGIGLIGIELIGFIFACCLANNVRNYKRRNAY 228
            .||..||.|:.:..||.:||:|||||||::|||:||..|
  Fly   188 NSDIIKYAGLVIAAIEFVGFVFACCLANSIRNYRRRAEY 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 96/216 (44%)
tetraspanin_LEL 106..187 CDD:239401 33/82 (40%)
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 96/216 (44%)
tetraspanin_LEL 104..188 CDD:239401 33/85 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467681
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 185 1.000 Inparanoid score I6383
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11759
87.900

Return to query results.
Submit another query.