DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and tspan33b

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_005159085.1 Gene:tspan33b / 567512 ZFINID:ZDB-GENE-060503-607 Length:266 Species:Danio rerio


Alignment Length:257 Identity:60/257 - (23%)
Similarity:108/257 - (42%) Gaps:55/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKYILFIFNTIVSVIGILGIVYGVLILKSIGVVEVNGQVGFPIQALMPIILISLGSIVVFISFLG 72
            ::|.||.|:.:..|..:|.:..||..........|..  .|.|..  .:|||.:|.::.||:|.|
Zfish    20 IRYFLFFFSFLFWVFSLLIVAIGVYAKAQKATDTVRD--SFLIDP--AVILIVVGVVMFFITFCG 80

  Fly    73 CCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHREEFENAMGNVIENAWNSEHTYKG----- 132
            |.||:||::.:...::..|.::.:.|:...:|.|.:.|:..:|:|..::.|  ..| |:.     
Zfish    81 CIGALRENIRLLKIFSFSLTLVFLTQMAIAILGFFYSEQTRDALGEFVKKA--IVH-YRDDLDLQ 142

  Fly   133 GVFDTIQKSLHCCGSSSALDY-------------IGKGDLVPPSCCS------------GSCLIP 172
            .:.|.|||...|||.::..|:             ..:...||.|||:            |..:..
Zfish   143 NLMDYIQKEFKCCGWTNYTDWSWNPYFNCSSSNPSNERCSVPFSCCTPLPRETVINSMCGFGIQT 207

  Fly   173 TN--------YYPGCRGKFV-----ELMTTGSDNAKYVGIGLIGIELIGFIFACCLANNVRN 221
            .|        |..||..:.|     .|:..|:     :.:||...::.|.:.:..|.:.:|:
Zfish   208 QNHLNATKSIYSVGCADRAVIWIESHLLLFGA-----LTLGLALPQIAGIVLSQILISEIRS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 59/253 (23%)
tetraspanin_LEL 106..187 CDD:239401 26/123 (21%)
tspan33bXP_005159085.1 Tetraspannin 36..262 CDD:278750 54/237 (23%)
penumbra_like_LEL 114..234 CDD:239411 26/122 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.