DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and cd81b

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001003735.1 Gene:cd81b / 445280 ZFINID:ZDB-GENE-040808-52 Length:238 Species:Danio rerio


Alignment Length:250 Identity:61/250 - (24%)
Similarity:104/250 - (41%) Gaps:56/250 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKYILFIFNTIVSVIGILGIVYGVLI-------LKSIGVVEVNGQVGFPIQALMPIILISLGSIV 65
            :||:||..|.|..:.|  |::.||.:       ..::.:::..|........:...:||::|:|:
Zfish    10 IKYMLFFLNFIFWLAG--GVILGVALWLRHDSQTSNLLMLQFEGNQAPGTFYISVYVLIAIGAIM 72

  Fly    66 VFISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHREEFENAMGNVIENAW------ 124
            :|:.||||.|||:||.|:..::.|.|:||...::...:..|.:|:.....:.|..:.|:      
Zfish    73 MFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFINRDTISTELINFYDAAYIKAVDP 137

  Fly   125 ---NSEHTYKGGVFDTIQKSLHCCGSSSALDYIGKGD------LVPPSCCSGSCLIPTNYYP--- 177
               .|..| ...|.:....:|.||         ||||      :|..|.|      |...:|   
Zfish   138 VDTTSRQT-ASKVLEVFHDNLDCC---------GKGDDNDLFKVVQTSLC------PKKTFPLDP 186

  Fly   178 ----GCRGKFVELMTTGSDNAKYVGIGLIGI------ELIGFIFACCLANNVRNY 222
                .|.   |:|....|:....:|:..:.|      |:|..:..||...|...|
Zfish   187 LISQSCH---VKLRNLFSEKLHVIGLAALVIAVIMVFEMIFTMVLCCAIRNAPAY 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 59/245 (24%)
tetraspanin_LEL 106..187 CDD:239401 21/102 (21%)
cd81bNP_001003735.1 Tetraspannin 9..232 CDD:278750 59/242 (24%)
CD81_like_LEL 113..204 CDD:239404 23/109 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.