DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and zgc:64051

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_956665.1 Gene:zgc:64051 / 393342 ZFINID:ZDB-GENE-040426-1349 Length:221 Species:Danio rerio


Alignment Length:245 Identity:64/245 - (26%)
Similarity:110/245 - (44%) Gaps:46/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCGTSMVKYILFIFNTIVSVIGILGIVYGVLILKSIGVVEVNGQVGFPIQALMPII-------- 57
            |.| ...:|||:.:.|.|..:.|......|:.::.            |...:|:|.:        
Zfish     1 MSC-LKCLKYIMCVVNFIFFICGAAIFGMGIYLMT------------FSRLSLLPSLQAMSIANT 52

  Fly    58 LISLGSIVVFISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHREEFENAMGNVIEN 122
            |...|.|:..:||||..||::|:.|:.:|:...|.||::.:|....|:..:..:.||.:.:.:.:
Zfish    53 LFITGIIITCVSFLGFLGALKENRCLLISFFILLFILMLAELAAACLMLMYESKIENFIKDDLVD 117

  Fly   123 AWN------SEHTYKGGVFDTIQKSLHCCGSSSALDYIGKGDLVPPSC-CSGSCLIPTNYYPGCR 180
            ..|      .:|..... :|.:|::..|||..:|.|:.|   .||.|| .||:    :|::.|| 
Zfish   118 GLNQSIKNRKQHNTTDD-WDKVQETFGCCGIQNATDWQG---FVPQSCNISGT----SNWHKGC- 173

  Fly   181 GKFVELMTTGSDNAKYVGIGLIG---IELIGFIFA----CCLANNVRNYK 223
              |..|..:...|....|||:|.   ||::|..|:    |.:..:...||
Zfish   174 --FKLLENSFESNLLSTGIGVIVVCIIEVLGMCFSMTLFCHINRSGLGYK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 60/232 (26%)
tetraspanin_LEL 106..187 CDD:239401 22/87 (25%)
zgc:64051NP_956665.1 Tetraspannin 6..213 CDD:278750 60/229 (26%)
CD53_like_LEL 101..189 CDD:239417 24/98 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.