DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and Tsp66E

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_523985.1 Gene:Tsp66E / 39017 FlyBaseID:FBgn0035936 Length:267 Species:Drosophila melanogaster


Alignment Length:278 Identity:79/278 - (28%)
Similarity:122/278 - (43%) Gaps:74/278 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DCGTSMVKYILFIFNTIVSVIGILGIVYGV------------LILKSIGVVEVNGQVGFPIQAL- 53
            |||....||:|.|||.|..|:|.  |::||            .:||.:....:. |...| ||: 
  Fly     4 DCGVWCAKYLLCIFNFIFFVLGT--IIFGVGLWLAVDKHSLIALLKLVESERIE-QFTQP-QAIE 64

  Fly    54 -MPIILISLGSIVVFISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVL--LFTH--REEFE 113
             :..:|:.:|:::.|:||||..||:|||.|:..:|.|||::|||.::....|  .|..  |.|.:
  Fly    65 QLAYVLLVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFFKDKVRAESK 129

  Fly   114 NAMGNVI------ENA------WNSEHTYKGGVFDTIQKSLHCCGSSSALDY-------IGKGD- 158
            |.:...|      ||.      ||.           :..:..|||.:...|:       .|||: 
  Fly   130 NFLQTTITSYSLGENVDATSLMWNQ-----------LMGNFGCCGINDYHDFDASPAWVNGKGNR 183

  Fly   159 LVPPSCC---SGSCLIP------TN-------YYPGCRGKFVELMTTGSDNA-KYVGIGLIGIEL 206
            .:|.:||   ..:.|:|      ||       |..||...|.|.:....:.. ..:.:|::.:.|
  Fly   184 TIPDACCILKDVAKLVPRDEDCTTNPSDSNSFYKKGCYEVFTEWLIRQRELVIVAIAVGIVHLVL 248

  Fly   207 IGFIFACCLA----NNVR 220
            |...||.|.|    |::|
  Fly   249 IILAFALCKAFAKYNDMR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 75/269 (28%)
tetraspanin_LEL 106..187 CDD:239401 28/118 (24%)
Tsp66ENP_523985.1 Tetraspannin 9..258 CDD:278750 73/263 (28%)
uroplakin_I_like_LEL 116..231 CDD:239409 29/125 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442980
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.