DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and TM4SF

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001261159.1 Gene:TM4SF / 37786 FlyBaseID:FBgn0020372 Length:292 Species:Drosophila melanogaster


Alignment Length:192 Identity:41/192 - (21%)
Similarity:80/192 - (41%) Gaps:35/192 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KYILFIFNTIVSVIGILGIVYGVLIL--KSIGVVEVNGQVGFPIQALMPIILISLGSIVVFISFL 71
            ||:::.:..::::.|...|..|..:|  .|:....|..::..|     ..||:.||.:...:.::
  Fly    11 KYLVYSYVVLLALTGAAQIFLGTSLLWGHSVYYGIVQNKLWAP-----AAILLCLGPVTFILCWM 70

  Fly    72 GCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHREEFENAMGNVIENAW------------ 124
            ||....:...|:...:|..|:..:.:|..........||....::...|::::            
  Fly    71 GCQATNQRKRCLLGMFAALLVACICVQFIICGWSLAMRENLPTSVEIFIDDSFVEFLDKFSRTKV 135

  Fly   125 NSEHTYKGGVFDTIQKSLHCCGSSSALDYIGKGDLVPPSCCS-------GSCLIPTNYYPGC 179
            ::.|     :::.:|..|.|||....|||  :...:|.||||       .:|  .|:|..||
  Fly   136 DNLH-----LWNRMQSQLQCCGVDGPLDY--RRLSLPWSCCSRPEHAYESAC--DTHYKRGC 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 41/192 (21%)
tetraspanin_LEL 106..187 CDD:239401 22/93 (24%)
TM4SFNP_001261159.1 Tetraspannin 9..224 CDD:278750 41/192 (21%)
uroplakin_I_like_LEL 111..197 CDD:239409 20/87 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.