DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and Tsp42Er

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster


Alignment Length:232 Identity:78/232 - (33%)
Similarity:117/232 - (50%) Gaps:37/232 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MVKYILFIFNTIVSVIGILGIVYGVLILKSIGVVEVNGQVGFPIQALMPIILISLGSIVVFISFL 71
            |::|:.|:||.:.:|:||..||..|:.:..|.          |...|:..:.|::||||..:||.
  Fly     7 MIRYLAFLFNFLCAVLGIATIVVNVIAIDQIA----------PKDQLILGLYIAVGSIVFLLSFF 61

  Fly    72 GCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHREEFENAMGNVIENAWNSEHTYKGGVFD 136
            ||.|||:||:|:|.:|||.:|::||:.   :|:||..|..||......::.|:..:    ...||
  Fly    62 GCFGAIKESICVTWAYATSMLVMLIVS---IVMLFVFRMHFEEDSITKLKQAFAKQ----TNTFD 119

  Fly   137 TI---QKSLHCCGSSSALDYIGKGD---LVPPSCCSGSCLIPTNYYPGCRGK----FVELMTTGS 191
            .:   |....|||.....||   ||   .||.||...:   .|.|..||..|    :.||:    
  Fly   120 AMAEYQTQYQCCGIYKLKDY---GDAYITVPSSCYDQN---DTPYRDGCLAKMETQYEELL---- 174

  Fly   192 DNAKYVGIGLIGIELIGFIFACCLANNVRNYKRRNAY 228
            ...|.||..|:.||:..|.|:..:..::||..||:||
  Fly   175 KGPKIVGWMLMVIEIGAFTFSTIMGVSLRNELRRSAY 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 71/220 (32%)
tetraspanin_LEL 106..187 CDD:239401 25/90 (28%)
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 70/213 (33%)
tetraspanin_LEL 93..174 CDD:239401 25/90 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467707
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.