DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and Tsp42Eq

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster


Alignment Length:232 Identity:61/232 - (26%)
Similarity:107/232 - (46%) Gaps:18/232 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCGTSMVKYILFIFNTIVSVIGILGIVYGVLILKSIGVVEVNGQVGFPIQALMPIILISLGSIV 65
            |.|||..:|...|:.:.:..|:..|.|.     ..|..::..:..|...:.:::.|:   ||.::
  Fly     1 MSCGTKALKVSSFVLDFLCCVLAALTIA-----ACSYALIAFSHSVAIRVPSILGIV---LGGLL 57

  Fly    66 VFISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHREEFENAMGNVIENAWNSE--H 128
            .|.:..||..|:|||:.||..||..||.|:..|:|   ::......:|......|.:||..:  |
  Fly    58 FFSTIFGCIAALRESIRMTWIYAAILLALVFSQIT---VILAQPINYELLANETIYDAWQGQLYH 119

  Fly   129 TYKGGVFDTIQKSLHCCGSSSALDYIGKGDLVPPSC-CSGSCLIPTNYYP-GCRGKFVELMTTGS 191
            :.:...|:.   ..||||.:...:|...|.::|.|| .:.:..:.|:.|. ||..:.......|:
  Fly   120 SDRMSYFEI---KYHCCGQTGPANYPDSGLVIPQSCYFNQNATVTTDLYTVGCNHQLAAAFVKGT 181

  Fly   192 DNAKYVGIGLIGIELIGFIFACCLANNVRNYKRRNAY 228
            ...|.....::|:|::..|.|..||..::|.:||..|
  Fly   182 RWEKITDWSVVGVEILTVIIAGLLAITLQNAERRRLY 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 53/214 (25%)
tetraspanin_LEL 106..187 CDD:239401 19/84 (23%)
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 53/214 (25%)
tetraspanin_LEL 95..173 CDD:239401 19/80 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.