DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and Tsp42Ek

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001246161.1 Gene:Tsp42Ek / 35621 FlyBaseID:FBgn0033133 Length:215 Species:Drosophila melanogaster


Alignment Length:234 Identity:67/234 - (28%)
Similarity:96/234 - (41%) Gaps:25/234 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCGTSMVKYILFIFNTIVSVIGILGIVYGVLILKSIGVVEVNGQVGFPIQALMPIILISLGSIV 65
            |.|.:..||..|...||:.::.|:..|....|.|....:..:             :.|..||.|:
  Fly     1 MGCTSGCVKCFLNTLNTLNALSGLSLIAIATLALSKAPIAYI-------------LFLYGLGGII 52

  Fly    66 VFISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHREEF-ENAMGNVIENAWNSEHT 129
            ...:.|||||...|:||||.:|...||..||:.| ..:..|...||: |......::..|: |..
  Fly    53 FVSAVLGCCGICMENVCMTATYGFLLLAQLIISL-LGIFRFKFTEEYIEKFAAEEVQMKWD-EEL 115

  Fly   130 YKGGVFDTIQKSLHCCGSSSALDYIGKG-DLVPPSCCSGSCLIPTNYYPGCRGK----FVELMTT 189
            .:.|..|..|....|||..|..||:..| ..:||||.........:|..||..|    ||.|.:.
  Fly   116 VEPGAMDIYQTVYECCGRDSPDDYVAIGRQTLPPSCYPQEDPQMPHYLAGCVQKSSENFVVLFSY 180

  Fly   190 GSDNAKYVGIGLIGIELIGFIFACCLANNVRNYKRRNAY 228
            ..| ..::.   :||.::..|.|..|....|..:.|..|
  Fly   181 AHD-TNWIA---LGITILMMIAAFYLVGRFRKQRVRYTY 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 62/216 (29%)
tetraspanin_LEL 106..187 CDD:239401 26/86 (30%)
Tsp42EkNP_001246161.1 Tetraspannin 7..202 CDD:278750 61/213 (29%)
tetraspanin_LEL 94..174 CDD:239401 23/80 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.