DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and Tsp42Ei

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001260756.1 Gene:Tsp42Ei / 35618 FlyBaseID:FBgn0033130 Length:229 Species:Drosophila melanogaster


Alignment Length:240 Identity:67/240 - (27%)
Similarity:115/240 - (47%) Gaps:30/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCGTSMVKYILFIFNTIVSVIGILGIVYGVLIL-------KSIGVVEVNGQVGFPIQALMPIIL 58
            |..|.:.||::|.:.|.:.||:|:..|.:|:..|       .|||.....|            ::
  Fly     1 MGLGATTVKHVLLLLNFVFSVLGLALIAFGIFFLISAAENAVSIGKNVAGG------------LI 53

  Fly    59 ISLGSIVVFISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTH--REEFENAMGNVIE 121
            |:||.:::.|:..||..||.|:....:.|...:::|::.||.|:. :.:|  ::....::....:
  Fly    54 IALGVVILIIAIFGCLAAIHEAPVRLLIYVGAVVLLILAQLIFLG-MSSHGTKDGISGSINEGFD 117

  Fly   122 NAWNSEHTYKGGVFDTIQKSLHCCGSSSALDY--IGKGDLVPPSCCSGS-CL-IPTNYY-PGCRG 181
            ..|.||.. :.|.....:..|.|||.:|:.||  |..|  :|.|||..| |: .|:..: .||:.
  Fly   118 RLWESERN-QTGALSYYESWLQCCGVNSSEDYWIIHHG--IPSSCCPESKCMDTPSRVFKTGCKA 179

  Fly   182 KFVELMTTGSDNAKYVGIGLIGIELIGFIFACCLANNVRNYKRRN 226
            .||:.:.......|.|...|:..|.:|.:|...|.::|:|..|||
  Fly   180 AFVKYLDDKLLVFKIVCWLLVIGEAVGAVFGWLLYSSVKNQSRRN 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 60/224 (27%)
tetraspanin_LEL 106..187 CDD:239401 25/87 (29%)
Tsp42EiNP_001260756.1 Tetraspannin 7..217 CDD:278750 60/225 (27%)
DUF373 <17..>101 CDD:299895 24/96 (25%)
tetraspanin_LEL 104..189 CDD:239401 24/87 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467685
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.