DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and Tsp42Eh

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster


Alignment Length:229 Identity:64/229 - (27%)
Similarity:118/229 - (51%) Gaps:7/229 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCGTSMVKYILFIFNTIVSVIGILGIVYGVLILKSIGVVEVNGQVGFPI-QALMPIILISLGSI 64
            |.|.|.:::|:|.:.:.|.::.|.|.|.||..:|.|:.  |....:|... :.|..::.:.||::
  Fly     1 MYCTTRLLRYVLCVISGICALGGCLLIWYGAWLLDSLS--EEQRMLGMDHGEDLAAVLCVLLGTV 63

  Fly    65 VVFISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHREEF-ENAMGNVIENAWNSEH 128
            :|..|..|.....::|..:.:.||..|:.|||:|:..|.:.:....:| .:::...:::.|:.:|
  Fly    64 IVVASIFGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFLPDSLRQGLDDLWDLQH 128

  Fly   129 TYKGGVFDTIQKSLHCCGSSSALDYIGKGDLVPPSCC-SGSCLIPTN-YYPGCRGKFVELMTTGS 191
            . .....:|.::.|||||.:||.||:....:.||||| :..|....| :..||..||.|.:...:
  Fly   129 E-GNSTLNTYEEWLHCCGRNSAEDYLHLEKMPPPSCCLNRDCTKHLNLFMTGCEVKFKEYVGAKT 192

  Fly   192 DNAKYVGIGLIGIELIGFIFACCLANNVRNYKRR 225
            .|...:...|:..|..|.:..|.|.:::||::.|
  Fly   193 ANFHSLSWFLVIFEFAGSVTTCYLVDSIRNHRDR 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 58/214 (27%)
tetraspanin_LEL 106..187 CDD:239401 25/83 (30%)
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 58/214 (27%)
tetraspanin_LEL 109..192 CDD:239401 25/83 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467684
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570819at33208
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.