DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and Tsp42Ef

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster


Alignment Length:232 Identity:64/232 - (27%)
Similarity:106/232 - (45%) Gaps:23/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TSMVKYILFIFNTIVSVIGILGIVYGVLI-----LKSIGVVEVNGQVGFPIQALMPIILISLGSI 64
            ||.||.|::..:.:.:::.::.|.:|:.:     |..||.:...|.||             ||:.
  Fly     4 TSSVKLIVYALDVLCTLLALVLISFGIYVAVSYNLNEIGQLTAYGYVG-------------LGAA 55

  Fly    65 VVFISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHREEFENAMGNVIENAWNSEHT 129
            .:.:...|...|.||:||.|:::..||.:::|.|...|.||.|..:...:.:.|.:|..| .|..
  Fly    56 ALLVVLWGYLSAWRENVCCTVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLANALEATW-EEEL 119

  Fly   130 YKGGVFDTIQKSLHCCGSSSALDYIGKGDLVPPSCC--SGSCLIPTN-YYPGCRGKFVELMTTGS 191
            ...|.....|....|||..|..||| ..:.:||..|  :.....|.| .:.|||.:|.......:
  Fly   120 NSPGAMSLYQNWFQCCGRGSPQDYI-VNERLPPETCFRNHDKSKPENLIHTGCRVEFENYWQHLT 183

  Fly   192 DNAKYVGIGLIGIELIGFIFACCLANNVRNYKRRNAY 228
            .....:.:.|||.||:..:.:|.|.|::||..||:.:
  Fly   184 KIFNILALVLIGFELLLSVISCRLCNSIRNDARRSYF 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 58/218 (27%)
tetraspanin_LEL 106..187 CDD:239401 23/83 (28%)
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 58/218 (27%)
tetraspanin_LEL 103..181 CDD:239401 22/79 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443019
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.