DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and Tsp42Ec

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster


Alignment Length:229 Identity:78/229 - (34%)
Similarity:121/229 - (52%) Gaps:14/229 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCGTSMVKYILFIFNTIVSVIGILGIVYGVLILKSIGVVEVNGQVGFPIQALMPIILISLGSIV 65
            |.|.:.:|.:||:|.|.:..::|||.||.|.::|..:...:|.|....|  ..:||.:..||.::
  Fly     1 MGCLSGIVNFILYIVNIVFLIVGILLIVLGSIMLSDLSRFDVAGSGTDP--NTIPICVTVLGGLI 63

  Fly    66 VFISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHREEFENAMGNVIENAWNSEHTY 130
            ..:||.||.|..|:|||||.:|.:.:.:|.||||.....:|.:|..|...|.|::...|:| |.|
  Fly    64 FVVSFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSAFLGDMSNLVNLLWDS-HDY 127

  Fly   131 KG-GVFDTIQKSLHCCGSSSALDYIGKGDLVPPSCC-----SGSCLIPTNYY--PGCRGKFVELM 187
            .. ||   ::::..|||.:|..:|...|..||.:||     ..:|..|:.|.  |||..||.|..
  Fly   128 TAMGV---LEETFGCCGDTSYTNYNNIGLSVPGTCCGYLDRQATCNTPSVYQSRPGCSAKFEEFW 189

  Fly   188 TTGSDNAKYVGIGLIGIELIGFIFACCLANNVRN 221
            ....|..::.|:||...:|:.|:.|..|.|.:|:
  Fly   190 NDNMDIIRWSGLGLCIFDLVVFLIAGALTNCMRS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 75/218 (34%)
tetraspanin_LEL 106..187 CDD:239401 30/88 (34%)
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 75/219 (34%)
tetraspanin_LEL 104..193 CDD:239401 30/92 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467682
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.