DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and cd63

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_955837.1 Gene:cd63 / 321461 ZFINID:ZDB-GENE-030131-180 Length:237 Species:Danio rerio


Alignment Length:237 Identity:75/237 - (31%)
Similarity:121/237 - (51%) Gaps:29/237 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTSMVKYILFIFNTIVSVIGILGIVYGVLILKSI-GVVEVNGQVGFPIQALMPIILISLGSIVVF 67
            |...|||:||.||.|..:.|:..||.|:|:..|: ....:.|..|      .|::||.:|.|:.|
Zfish     6 GAKCVKYLLFFFNFIFWLCGLALIVLGILVHVSLHNTAILQGASG------SPMVLIVVGVIIFF 64

  Fly    68 ISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHR---EEFENAMGNVIENAWNSEHT 129
            |||.|||||.:|:.||.:::|..|.:::|.::...:..:..|   .|..:...|.:...:|....
Zfish    65 ISFFGCCGAWKENQCMVVTFAIILSLIVITEIGAGIAGYIFRGKVNELLDQSFNTMIAGYNKTEE 129

  Fly   130 YKGGVFDTIQKSLHCCGSSSALDYIG-KGD--LVPPSCCS--------GSCLIPT-NYYPGCRGK 182
            |: ...|:|||.|.|||.:|:.|::. ..|  .||.|||.        |:...|| .|..||:  
Zfish   130 YR-TTLDSIQKQLKCCGGNSSSDWVNFSADHISVPDSCCKNVTKNCGIGAMTKPTVIYLEGCQ-- 191

  Fly   183 FVELMTTGSDNAKYVGIG--LIG-IELIGFIFACCLANNVRN 221
             ..|.|...:|..::.:|  :|| :::.|.:.||.|:..:|:
Zfish   192 -PILETRIKENILWIAVGALVIGFVQITGIVLACILSRAIRS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 73/229 (32%)
tetraspanin_LEL 106..187 CDD:239401 27/95 (28%)
cd63NP_955837.1 Tetraspannin 9..230 CDD:278750 73/230 (32%)
CD63_LEL 103..202 CDD:239419 29/102 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.