DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and Tsp2A

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster


Alignment Length:247 Identity:59/247 - (23%)
Similarity:105/247 - (42%) Gaps:51/247 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKYILFIFNTIVSVIGILGIVYGVLILKSIG------VVEVNG-QVGFPIQALMPIILISLGSIV 65
            |||.||.||.:..:|........|.:....|      ::|... .:|.       .:||.:..::
  Fly    19 VKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQSFYIGV-------YVLIGISIVM 76

  Fly    66 VFISFLGCCGAIRESVCMTMSYATFLLI-------LLILQLTFVVLLFTHREEFENAMGNVIENA 123
            :.:|||||..|:.|:     :.|.|:.:       :.|:..:.|:|.|:........:.||....
  Fly    77 MAVSFLGCLSALMEN-----TLALFVFVGTQVFGFIAIVAGSAVLLQFSTINSSLQPLLNVSLRG 136

  Fly   124 W--NSEHTYKGGVFDTIQKSLHCCGSSSALDYIGKGDLVPPSC---CSGSCLIPTNYYPGCRGKF 183
            :  .||:||...|...||:::.|||::...||:.....:|.||   .||:.     ::.||    
  Fly   137 FVATSEYTYSNYVLTMIQENIGCCGATGPWDYLDLRQPLPSSCRDTVSGNA-----FFNGC---- 192

  Fly   184 VELMT------TGSDNAKYVGIGLIGI--ELIGFIFACCL---ANNVRNYKR 224
            |:.:|      ||...|..:.:||:.:  .::.|:....:   .....||:|
  Fly   193 VDELTWFFEGKTGWIVALAMTLGLLNVICAVMSFVLVQAVKKEEEQASNYRR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 56/240 (23%)
tetraspanin_LEL 106..187 CDD:239401 23/85 (27%)
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 56/233 (24%)
tetraspanin_LEL 116..204 CDD:239401 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.